The post argues that learning is most effective when tailored to an individualâs own pace and interests; formal schooling often fails because it imposes fixed sequences and generic knowledge. To succeed in interviews and real work, one must build functional, exceptional knowledgeâespecially in software developmentâby creating personal projects such as inâmemory databases with distributed hash tables, documenting them, writing tutorials, and sharing plugins online. Starting early, a learner should map their curiosities into a mindâmap, iteratively exploring new topics and building side projects that evolve into businesses; this cycle of selfâeducation yields true expertise beyond rote diplomas.
Each child is a unique creation, and humanity must craft a culture that inspires, nurtures, and educatesâan architecture of art where wisdom, not manipulation, guides life. The post argues that wars, borders, and cults are arbitrary tricks that waste time and cause poverty; the remedy lies in simple yet profound ideas: clear, dignified schooling that builds abilities for future generations to fix climate and end war, while abandoning bad ideas, hate, and endless taking.
#0914 published 04:26 audio duration387 wordscultureeducationchildrengenerationsclimatewarpoverty
The poem celebrates humanityâs inherent beauty and freedom, arguing that broken cultures lose their nurturing power while compromises erode wisdom. It calls for unity, growth, and education that enlightens the young without stagnation; poverty is seen as a source of terror and war merely a temporary ceasefire. Schools should be free from cruelty, and the world belongs to future generationsâso we must become farâseeing wise beings.
#0913 published 02:19 audio duration174 wordspoetrycultureunityhumanity
The post explains that curiosity is simply noticing something newâlike learning to use a 3âD printerâwhile an idea is what emerges from that curiosity and can be developed into something useful or creative; the author illustrates this with examples such as building a multiâlayer 3âD printed wallet, telling a âyoâŻmamaâ joke he claims to have invented, and finally describing his new Lowbrowâart technique of using kitten head proportions to guide adult portrait drawings. He stresses that ideas are worth recording, nurturing, and never underestimating, because they can bring joy, laughter, and personal fulfillment when turned into tangible projects or artworks.
#0912 published 15:45 audio duration1,257 words1 linkideacuriosity3d printingwallet designlowbrow artportraitpainting
A young woman from an ancient city, inspired by a beautiful kitten, sought to master art and journeyed to a renowned artistic village where she consulted its wisest man. He instructed her to meditate, but after each meditation the woman returned with newly invented toolsâsightâsize, proportional divider, grid method, graphite paper, viewing frame, light box, camera obscuraâthat gradually shaped modern drawing techniques; yet each invention prompted the wise man to send her back, insisting on simplicity. After many experiments and days of practice, she finally understood that only a simple thumb measurement was needed, defeated the wise man in front of the village, and thus proved her mastery. The tale concludes with the moral that those who impede artâwhether by belittling, profiting, or claiming wisdomâwill be remembered as fools.
#0911 published 04:31 audio duration306 words11 linksstorymythartinventiondrawing toolscamera obscuralightboxgridmethodgraphitepaperviewingframekrita
The post explains that starting an art practice by using reference images directlyâoften called âtracingââlets you learn quickly and build a personal style through shortcuts and visual pleasure. It recommends beginning with affordable tools like a $50 pen, tablet, and free software such as Krita to access its referenceâimage tool and create your own compositions. Once you master laying out scenes from references, you can shift to freehand drawing while still grounding yourself in realistic physics, but also bending reality to invent colors and light. The author illustrates this with an example of painting a politicianâs face: study the eyes and laughter from references, then compose the final piece freehand, ensuring harmony and purpose behind each sketch.
#0910 published 06:36 audio duration527 words2 linksreference-imageskritafreehandhyperrealistic
The author reflects on reshaping our world by uniting cultures through education, arguing that only by ending global povertyâvia universal income banks and free schoolingâcan people rise from low levels of learning. He stresses the need for a topâdown design that brings all cultures together, uses art to show students what a classroom should be, and believes this educational revolution will lift minds and dissolve borders.
#0909 published 03:12 audio duration273 words2 linkspoetryeducationglobalpovertyuniversalbasicincomeartculture
By applying a reference image directly onto the canvas, an artist can create a faithful hyperârealistic reproduction that serves both as a master study of the subject and proof of their skill. Once this stage is mastered, the artist gains a solid launchpad from which to explore eye, lip, nose, cheek, and hand details through targeted tutorials; these lessons refine positioning and deepen artistic control. As the process continues, the artist learns to simplify shadows and stylize features, transforming detailed studies into memorized faces that can be reproduced spontaneously. This progressionâfrom precise hyperârealism through simplification to fullâbody posesâbuilds a memory bank of facial features and postures, enabling the sketching of complete scenes and ultimately producing uniquely personal works.
#0908 published 04:12 audio duration318 wordshyper-realistreference-imageeye-drawingpaintingart-techniquestylizationfull-body-painting
The post explains that art is an innate skill that needs structured practiceâmuch like learning to write or ride a bikeâand that tools such as ruled paper, grids, and proportional dividers help beginners stay on track; it also encourages using free openâsource programs (e.g., Krita) for color picking and image references so you can learn to mix colors effectively; the writer suggests inexpensive yet effective suppliesâpencils, canvas or graphite paper, a small projector for tracing images, and eventually a pen tabletâto build confidence before moving into more advanced techniques like 3âD shading; ultimately, mastering these basics will let you create art that transforms lives and invites others to join your creative journey.
#0907 published 09:39 audio duration916 words6 linksartdrawingpencilsgridstracing-papercolor-pickingkritaprojectortutorials
The post argues that many âmentorâ artists underestimate newcomers, guiding them on a long journey rather than letting them become equally skilled, and that true art must be free of manipulation, selfâdelusion, and lies. The author declares everyone a natural artist and invites those who use art merely to showcase themselves to switch to magic, whose code is clear and unviolated. Digital art, the writer says, should not simply copy life but elevate it by using its full range of toolsâ3âD modeling, perspective, shadowsâand techniques such as photoâbashing, colorâpicking, and tracing; freehand sketches are just one style. Finally, the post stresses that handâeye coordination develops naturally when aided by gadgets, that young people already possess the intelligence to learn art, and that artists should not take the medium away from them.
The author explains why choosing the right reference photo is key for any portrait: a model must pick an image that truly shows her face under good lighting, from the proper angles, and in a way she feels it represents her. He argues that even with 3âD rigs or many photos, the final choice still needs the modelâs approval, otherwise the finished painting will feel wrong to the subject. The post contrasts simple photo selection with more complex photogrammetry, notes how stylized changes can be added after a solid base, and stresses that an artistâs responsibility is to capture the modelâs real appearance before adding any idealisations. Links to a titleâimage contest and a timeâlapse video are included as examples.
#0905 published 06:49 audio duration538 words2 linksportraitphotogrammetry3d-modelingphoto-selectionpainting
The post is a streamâofâconsciousness meditation on the human condition, arguing that true learning comes from stepping outside of pain and recognizing how our own missteps become the root of suffering. The author uses art as an illustration: good work fails if it only paints misery, just as war propaganda masks truth. He tells us to âcrawl through a tunnel of shitâ â i
#0904 published 18:11 audio duration1,383 wordspoetryfreeformessayselfhelpartmusicfilmnarrative
The author explains that creating art is not magic but a systematic process of navigation through techniquesâusing reference images, tracing paper, grid methods or digital toolsâto learn composition, color sampling, and mixing; practice turns these steps into habits, just as learning to navigate a city. He sees the first âlobbyâ of art as a place where beginners become perfect artists by mastering fundamentals, then expanding beyond them, and he frames art as a test of worthiness that rewards teachers who bring others into this starting circle so they too can grow. Ultimately, good art is defined not by subjective feeling but by its power to change lives, and new schools of art will emerge to free humanity from poverty and darkness.
#0903 published 09:22 audio duration839 words7 linksartdigital-artreference-imagestracing-papergrid-methodcolor-pickingartist-development
The post argues that a painting should âspeakâânot with misery, but with meaningâand that its message can be either inspirational or humorous. It suggests blending images with text, stories etched on stone walls, stillâlife scenes of books and objects, or punchlines framed by a funny setup (like a cat in a suit) to bring both mood and laughter into the viewerâs day. By using familiar quotes or personal joy as sources of inspiration, an artist can create works that lift spirits and help people balance their lives, even though not everyone will laugh or be inspired. The author ends with links to a âTitle Imageâ contest and timeâlapse video for further reference.
#0902 published 04:52 audio duration316 words2 linkspoetrypaintingartinspiration
The post outlines three main approaches to artâQuasimodo, Digital Art, and Lowbrowâeach with its own flavor. Quasimodo represents traditional classroom learning that can feel formulaic, yet some teachers are revisiting it to make it more innovative. The Digital Art method highlights how modern tools empower artists by bringing Renaissance techniques into contemporary practice, with light projection seen as a fundamental teaching aid. Finally, Lowbrow art embraces preset proportions and simple equipment to create charming, accessible works that resonate with viewers; the author shares a personal anecdote illustrating how this style can delight both artist and audience alike.
#0901 published 06:00 audio duration392 wordsartdigital artlowbrowpaintingtoolseducation
This post explains a simple, repeatâbased method for drawing faces quickly and accurately. It suggests using tracing paper, a projector or transparent digital layers to get proportions right at first glance, then skipping an initial sketch and painting shadows immediately. By repeatedly copying portraits with similar lighting, the artist learns to map key featuresâeyes, nose, mouthâinto their correct positions before adding details, so that later compositions feel natural and consistent. In short, memorizing a face through repetition builds a mental âmapâ of light, shadow and feature placement, enabling an artist to produce at least one finished portrait per day with minimal extra steps.
#0900 published 04:55 audio duration413 wordspaintingportraitfacetechniquepracticerepetitiondigital arttracing paperprojectorairbrushproportionslayers
The post argues that true learning comes from following your curiosityâcombining art and programming, mastering tools like regular expressions through handsâon practiceâand that fun is essential to retain knowledge. It contrasts the hackerâs selfâlearning style with traditional college experience, claiming graduates often lack deep retention and can be reâtested to separate what they learned independently from classroom teaching. The author suggests this could improve schools (and even bring prizes). Finally he links a career built on knowledge to larger goalsâending poverty, advancing humanity, and achieving global consensus on issues like the ozone holeâconcluding that real education and wealth creation are intertwined for becoming a great being.
#0899 published 10:10 audio duration726 wordseducationprogrammingperlregexlearningcareerarthacker
The post argues that the current education system is deliberately designed to make students feel inadequate, relying on memorization and standardized tests rather than true learning. It claims teachers, principals, and politicians work together in a âgroupâthinkâ scheme to keep students dependent on moneyâdriven grades, while free libraries and selfâeducation are presented as the only real way to acquire knowledge and escape poverty. The author urges readers to take charge of their own learningâthrough books, videos, art, design or programmingâto become competent thinkers and ultimately âgreat beingsâ who can contribute meaningfully to society.
#0898 published 18:51 audio duration1,277 wordseducationteachersstudentsschoollearningessay
In this post the author reflects on how children remember and expose their teachersâ lies, thanks to their growing connectivity and knowledge. The writer argues that as people age they tend to underestimate the power of modern information, yet the younger generation can quickly catch up with any misstep, especially when a teacher fails to deliver real learning. By recalling their own school daysâwhere students tested instructors for worthinessâthe author stresses that teachers must show genuine learning and care if they want childrenâs respect. Proper education, audio books, healthy habits, and sincere effort will extend life expectancy and help parents/teachers learn from their own mistakes.
#0897 published 05:34 audio duration472 words4 linkspoetryeducationteachersstudentsyoutubeaudio-books
The author contends that true art is lifeâchanging and sees truth as lofty mountain peaks guiding the creative spirit; by traveling many roads, cultivating knowledge, wisdom, and greatness, one ignites an inner core whose âcoronal ejectionâ reaches those peaks, while continuous learning keeps liars at bay. The post urges us to add fire through our works, not merely follow directions, and to light that fire in order to counter lies, hunger, and wrongness so that everything can be made right.
#0896 published 04:48 audio duration289 words2 linkspoetryartwritingimagecontest
I spent my college years oscillating between philosophy and art, first struggling through a dull Descartesâcentric course that left me craving deeper insight into Ĺ˝iĹžekâs ideas and the distinction between Ayn Randâs philosophy and politics, then finding creative fulfillment in an art class where I learned practical techniques like layering paint to avoid bleeding under tape; meanwhile my teacherâs informal styleâcalling me âpigâ behind my back yet later teaching me projector tricksâillustrated how professors can both insult and inspire. After making the deanâs list, I ventured into Michiganâs Nordhouse Wilderness with a group of friends, where I met a traveling philosopher who shared his own adventures on a bicycle, and together we reflected on human complexity, selfâcare, and the joy of learning, concluding that our lives are not about perfection but about growth and becoming great beings.
#0895 published 10:38 audio duration891 words1 linkcollegephilosophyartpaintingeducationstudentsteacherslearningselfreflectiontechnique
The post argues that conventional schoolingâstudying hard, cramming, and attending unsequenced lecturesâfails to give meaning to tests or true knowledge; it portrays education as essentially a mechanism for income, retirement, hedges, and profit maximization, with college loans engineered to extract maximum value through automatic deductions. The author uses the example of an art teacher who lets students trace repeatedly, claiming that mastery comes from countless repetitions (100th trace making one amazing, 1âŻ000th revolutionary) rather than guidance, and concludes by urging selfâeducation: start with highly regarded books and keep learning until you become a âGreat Beingâ like the worldâs brilliant intellectuals.
#0894 published 03:58 audio duration265 wordspoetryschooleducationbooksself-learning
The article explains why coloring a portrait face in hyperârealism is challenging: no single hue fits every detail, and each feature often requires a slightly different shade. It recommends working from a reference image, using a color picker and occasionally shifting hues semiârandomly, while keeping the source and final picture in sync. The author stresses starting with a clean sketch, then creating a blackâandâwhite version of the source, adding a âColorâ layer that imposes hue but preserves value, and applying filters (such as GâMIC) beforehand to see a reliable preview and avoid surprises during painting.
#0893 published 03:32 audio duration307 words1 linkpaintingcolorportraithyperrealismgmickritagimp
The post presents a straightforward, teacherless workflow for learning drawing and painting that relies on three core stagesâsketch, value (blackâandâwhite) study, and color applicationâand demonstrates how each stage can be executed with simple tools such as a grid, wall projector or an image reference in Krita. By first building a clean sketch using the grid or projected image, the artist trains hand and mind before moving on to a blackâandâwhite value study that captures light and shadow; this layer is then used as the base for a separate color layer set to âColorâ mode so that hue and saturation are applied while the underlying values dictate shading. The method encourages selfâstudy by letting artists sample colors from their reference, gradually developing an intuition for how hues shift across value levels, and ultimately fostering a personalized sequence of learning that can be adapted to each studentâs pace and curiosityâan approach the author hopes will inspire new âschoolsâ built around selfâeducation rather than traditional instruction.
#0892 published 04:17 audio duration369 words4 linksartdigitalpaintingkritasketchingreferenceimagecolorlayersselflearningtutorial